Lineage for d1gsma2 (1gsm A:91-206)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753851Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species)
  7. 2753852Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries)
  8. 2753854Domain d1gsma2: 1gsm A:91-206 [65536]

Details for d1gsma2

PDB Entry: 1gsm (more details), 1.9 Å

PDB Description: a reassessment of the madcam-1 structure and its role in integrin recognition.
PDB Compounds: (A:) mucosal addressin cell adhesion molecule-1

SCOPe Domain Sequences for d1gsma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsma2 b.1.1.4 (A:91-206) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvliegr

SCOPe Domain Coordinates for d1gsma2:

Click to download the PDB-style file with coordinates for d1gsma2.
(The format of our PDB-style files is described here.)

Timeline for d1gsma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsma1
OSZAR »